PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 29790.m000809
Common NameLOC8276945, RCOM_0789650
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Acalyphoideae; Acalypheae; Ricinus
Family GRAS
Protein Properties Length: 416aa    MW: 46776.9 Da    PI: 6.8702
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
29790.m000809genomeJCVIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS331.81.3e-101354151374
           GRAS   1 lvelLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilkfshl 96 
                    l++lLl+cA+  ssg+l++a+a+L+++sel+s +gd+mqRlaa f+ ALa rl++ +++lykal+ ++++++   ++  ++ lf  + P+l f++ 
  29790.m000809  35 LIQLLLKCANDASSGNLHRADACLSEISELSSVSGDSMQRLAARFASALAIRLVKRWPGLYKALNHEAQQPQVNLDR--VRPLFARALPYLSFAYA 128
                    689*************************************************************9999987555555..7789************* PP

           GRAS  97 taNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnvlvakrledlele 192
                    +  +++l+a+ +e+++Hi+D++ +    W++Ll++La  p+g+p+l+ T ++     +k  l ++g+rL k Ae+ ++ f+f++l   +l dl+ +
  29790.m000809 129 IIARTLLQAMTHEHTIHIVDLGSGDSKLWVPLLRSLAHSPNGSPHLKFTCLNT----DKAILDKLGQRLVKEAEASDMAFQFHPL-NISLRDLTAD 219
                    *****************************************************....9**************************6.779******* PP

           GRAS 193 eLrvkpgEalaVnlvlqlhrll............desvsles..erdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsleak 274
                    +L+v +gEala  ++l+lh ll            ++s+++++  + +++L +v+s+sP+++ +veqeadhn +++ +rf+e l+yysa+fds++a+
  29790.m000809 220 MLQVASGEALAFISILNLHLLLaeddrvdahfggNRSTCIKDckQMSDFLAMVRSMSPRLLFLVEQEADHNLNRLPDRFIEGLHYYSAVFDSIDAT 315
                    *********************************977777776667889*********************************************998 PP

           GRAS 275 lpres..eerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLv 368
                    l  +   e+r+++E++ +grei+n+vaceg er erhe+ +kW +rl +aGFkpv++  + +++ak +++ ++ +gy+  +e+ sl+++W++rp++
  29790.m000809 316 LVGNLgsEDRMVLEEM-FGREIENIVACEGLERYERHERCGKWGMRLARAGFKPVQMWCNFEQEAKQMVEAFA-KGYKTVSERWSLMICWHERPIY 409
                    8665444899999999.********************************************************.9********************* PP

           GRAS 369 svSaWr 374
                    +v+aW+
  29790.m000809 410 AVTAWT 415
                    *****6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098547.7849396IPR005202Transcription factor GRAS
PfamPF035144.4E-9935415IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
MSSITPLLKP DVTLSLALSS ASPSPYETQE RGIRLIQLLL KCANDASSGN LHRADACLSE  60
ISELSSVSGD SMQRLAARFA SALAIRLVKR WPGLYKALNH EAQQPQVNLD RVRPLFARAL  120
PYLSFAYAII ARTLLQAMTH EHTIHIVDLG SGDSKLWVPL LRSLAHSPNG SPHLKFTCLN  180
TDKAILDKLG QRLVKEAEAS DMAFQFHPLN ISLRDLTADM LQVASGEALA FISILNLHLL  240
LAEDDRVDAH FGGNRSTCIK DCKQMSDFLA MVRSMSPRLL FLVEQEADHN LNRLPDRFIE  300
GLHYYSAVFD SIDATLVGNL GSEDRMVLEE MFGREIENIV ACEGLERYER HERCGKWGMR  360
LARAGFKPVQ MWCNFEQEAK QMVEAFAKGY KTVSERWSLM ICWHERPIYA VTAWTC
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A9e-28354144374GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002525912.10.0PREDICTED: scarecrow-like protein 3
TrEMBLB9SIU30.0B9SIU3_RICCO; DELLA protein SLR1, putative
STRINGPOPTR_0004s21850.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF158131011
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.11e-91scarecrow-like 3